You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1216347 |
---|---|
Category | Proteins |
Description | The Bovine VEGF-A yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine VEGF-A applications are for cell culture, ELISA standard, and Western Blot Control. The Bovine VEGF-A yeast-derived recombinant protein can be purchased in multiple sizes. Bovine VEGF-A Specifications: (Molecular Weight: 19.2 kDa) (Amino Acid Sequence: APMAEGGQKPHEVVKFMDVYQRSFCRPIETLVDIFQEYPDEIEFIFKPSCVPLMRCGGCCNDESLECVPTEEFNITMQIMRIKPHQSQHIGEMSFLQHNKCECRPKKDKARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR) (Gene ID: 281572). |
Form/Appearance | Lyophilized |
Purity | 98% |
MW | 19.2 kDa |
Target | VEGF-A |
Protein Sequence | APMAEGGQKPHEVVKFMDVYQRSFCRPIETLVDIFQEYPDEIEFIFKPSCVPLMRCGGCCNDESLECVPTEEFNITMQIMRIKPHQSQHIGEMSFLQHNKCECRPKKDKARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR |
Protein Length | 164 |
Source | Yeast |
Biological Origin | Bovine |
Storage | -20°C |
Note | For research use only |
Expiration Date | 6 months from date of receipt. |
Bovine |