Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

Bovine CCL5 protein

SKU: orb1216355

Description

The Bovine CCL5 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine CCL5 applications are for cell culture, ELISA standard, and Western Blot Control. The Bovine CCL5 yeast-derived recombinant protein can be purchased in multiple sizes. Bovine CCL5 Specifications: (Molecular Weight: 7.9 kDa) (Amino Acid Sequence: SPYASDTTPCCFAYISRPLPRTHVQEYFYTSSKCSMAAVVFITRKNRQVCANPEKKWVREYINALELS) (Gene ID: 327712).

Research Area

Immunology & Inflammation

Images & Validation

Key Properties

SourceYeast
Biological OriginBovine
TargetCCL5
Protein Length68.0
MW7.9 kDa
Purity98%
Protein SequenceSPYASDTTPCCFAYISRPLPRTHVQEYFYTSSKCSMAAVVFITRKNRQVCANPEKKWVREYINALELS

Storage & Handling

Storage-20°C
Form/AppearanceLyophilized
Expiration Date6 months from date of receipt.
DisclaimerFor research use only

Alternative Names

RANTES

Similar Products

  • Bovine CCL5 ELISA Kit [orb1498723]

    Bovine

    1 set (1 x capture antibody), 1 set (2 x capture antibody)
  • Bovine Rantes protein [orb753283]

    ELISA,  WB

    Greater than 95% by SDS-PAGE gel analyses

    9.7 KDa

    E.Coli

    200 μg, 1 mg, 50 μg, 100 μg
  • Bovine RANTES ELISA Kit [orb441888]

    Bovine

    78.125-5000 pg/mL

    18.8 pg/mL

    48 T, 96 T
  • Bovine RANTES ELISA Kit (Ready to Use) [orb549289]

    Bovine

    78.1-5000 pg/mL

    18.8 pg/mL

    48 T, 96 T
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

Protein Handling and Storage Guide
Protein Handling Guide
View Guide

Bovine CCL5 protein (orb1216355)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

5 μg
$ 300.00
25 μg
$ 540.00
DispatchUsually dispatched within 5-10 working days
Bulk Enquiry