You have no items in your shopping cart.
Cart summary
Bovine CCL5 protein
Catalog Number: orb1216355
| Catalog Number | orb1216355 |
|---|---|
| Category | Proteins |
| Description | The Bovine CCL5 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine CCL5 applications are for cell culture, ELISA standard, and Western Blot Control. The Bovine CCL5 yeast-derived recombinant protein can be purchased in multiple sizes. Bovine CCL5 Specifications: (Molecular Weight: 7.9 kDa) (Amino Acid Sequence: SPYASDTTPCCFAYISRPLPRTHVQEYFYTSSKCSMAAVVFITRKNRQVCANPEKKWVREYINALELS) (Gene ID: 327712). |
| Target | CCL5 |
| Form/Appearance | Lyophilized |
| Purity | 98% |
| Protein Sequence | SPYASDTTPCCFAYISRPLPRTHVQEYFYTSSKCSMAAVVFITRKNRQVCANPEKKWVREYINALELS |
| Protein Length | 68 |
| MW | 7.9 kDa |
| Source | Yeast |
| Biological Origin | Bovine |
| Storage | -20°C |
| Alternative names | RANTES |
| Note | For research use only |
Bovine CCL5 ELISA Kit [orb1498723]
Bovine
1 set (2 x capture antibody), 1 set (1 x capture antibody)Bovine Rantes protein [orb753283]
ELISA, WB
Greater than 95% by SDS-PAGE gel analyses
9.7 KDa
E.Coli
200 μg, 100 μg, 50 μg, 1 mg
