You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb584145 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to Beclin 1 |
| Target | BECN1 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human BECN1 |
| Protein Sequence | Synthetic peptide located within the following region: ENLEKVQAEAERLDQEEAQYQREYSEFKRQQLELDDELKSVENQMRYAQT |
| UniProt ID | Q14457 |
| MW | 50kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | ATG6, VPS30, beclin1 |
| Research Area | Cancer Biology, Cell Biology, Immunology & Inflamm Read more... |
| Note | For research use only |
| NCBI | NP_003757 |
| Expiration Date | 12 months from date of receipt. |

Sample Type: Human Fetal Heart, Antibody dilution: 1.0 ug/ml.

Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.

Lanes: 1: 50 ug HEK lysate, Primary Antibody dilution: 1:100, Secondary Antibody: Anti-rabbit-RPF, Secondary Antibody dilution: 1:10000, Gene Name: BECN1. BECN1 is supported by BioGPS gene expression data to be expressed in HEK293.

WB Suggested Anti-BECN1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: 721_B cell lysate. BECN1 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.
WB | |
Bovine, Canine, Equine, Mouse, Porcine, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-Fr, IHC-P, WB | |
Bovine, Porcine | |
Human, Mouse, Porcine, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-Fr, IHC-P, WB | |
Rabbit | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, ICC, IF, IHC, WB | |
Human, Rat | |
Rabbit | |
Polyclonal | |
Biotin |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review