BECN1 Rabbit Polyclonal Antibody

• Catalog Number: orb584145
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Beclin 1
• Target: BECN1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human BECN1
• Protein Sequence: Synthetic peptide located within the following region: ENLEKVQAEAERLDQEEAQYQREYSEFKRQQLELDDELKSVENQMRYAQT
• UniProt ID: Q14457
• MW: 50kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: ATG6, VPS30, beclin1
• Note: For research use only
• NCBI: NP_003757

Sample Type: Human Fetal Heart, Antibody dilution: 1.0 ug/ml.

Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.

Lanes: 1: 50 ug HEK lysate, Primary Antibody dilution: 1:100, Secondary Antibody: Anti-rabbit-RPF, Secondary Antibody dilution: 1:10000, Gene Name: BECN1. BECN1 is supported by BioGPS gene expression data to be expressed in HEK293.

WB Suggested Anti-BECN1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: 721_B cell lysate. BECN1 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.