You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb584053 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to Beclin 1 |
Target | BECN1 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Canine, Equine, Mouse, Porcine, Rabbit, Rat |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human BECN1 |
Protein Sequence | Synthetic peptide located within the following region: MVRMVPVLLSLLLLLGPAVPQENQDGRYSLTYIYTGLSKHVEDVPAFQAL |
UniProt ID | Q14457 |
MW | 50kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | ATG6, VPS30, beclin1 |
Note | For research use only |
NCBI | NP_003757 |
Sample Type: Human Adult Placenta, Antibody dilution: 1.0 ug/ml.
Sample Type: Human Fetal Heart, Antibody dilution: 1.0 ug/ml.
Rabbit Anti-BECN1 antibody, Formalin Fixed Paraffin Embedded Tissue: Human Heart, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.
Rabbit Anti-BECN1 antibody, Formalin Fixed Paraffin Embedded Tissue: Human Prostate, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.
Rabbit Anti-BECN1 Antibody, Catalog Number: orb584053, Formalin Fixed Paraffin Embedded Tissue: Human Lymph Node Tissue, Observed Staining: Cytoplasm, Primary Antibody Concentration: 1:100, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.
WB Suggested Anti-BECN1 Antibody Titration: 1 ug/ml, Positive Control: HepG2 cell lysate.
IF, IHC-Fr, IHC-P, WB | |
Bovine, Porcine | |
Human, Mouse, Porcine, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, FC, IF, IHC-Fr, IHC-P, WB | |
Bovine, Porcine | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, IHC-P, WB | |
Porcine, Rat | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |