BCKDHA Rabbit Polyclonal Antibody

• Catalog Number: orb583009
• Category: Antibodies
• Description: Rabbit polyclonal antibody to BCKDHA
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Sheep, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human BCKDHA
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 50kDa
• Target: BCKDHA
• UniProt ID: P12694
• Protein Sequence: Synthetic peptide located within the following region: NVISGIPIYRVMDRQGQIINPSEDPHLPKEKVLKLYKSMTLLNTMDRILY
• NCBI: NP_000700
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: MSU, MSUD1, OVD1A, BCKDE1A
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Human Jurkat Whole Cell, Antibody dilution: 1 ug/ml.

Sample Type: Human Adult Placenta, Antibody dilution: 1.0 ug/ml.

Positive control (+): MCF7 (N10), Negative control (-): HepG2 (HG), Antibody concentration: 1 ug/ml.

Rabbit Anti-BCKDHA Antibody, Catalog Number: orb583009, Formalin Fixed Paraffin Embedded Tissue: Human Lung Tissue, Observed Staining: Cytoplasmic in alveolar type I & II cells, Primary Antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-BCKDHA Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: MCF7 cell lysate. BCKDHA is supported by BioGPS gene expression data to be expressed in MCF7.