You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb583009 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to BCKDHA |
Target | BCKDHA |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Sheep, Zebrafish |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human BCKDHA |
Protein Sequence | Synthetic peptide located within the following region: NVISGIPIYRVMDRQGQIINPSEDPHLPKEKVLKLYKSMTLLNTMDRILY |
UniProt ID | P12694 |
MW | 50kDa |
Tested applications | IHC, WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | MSU, MSUD1, OVD1A, BCKDE1A |
Note | For research use only |
NCBI | NP_000700 |
Sample Tissue: Human Jurkat Whole Cell, Antibody dilution: 1 ug/ml.
Sample Type: Human Adult Placenta, Antibody dilution: 1.0 ug/ml.
Positive control (+): MCF7 (N10), Negative control (-): HepG2 (HG), Antibody concentration: 1 ug/ml.
Rabbit Anti-BCKDHA Antibody, Catalog Number: orb583009, Formalin Fixed Paraffin Embedded Tissue: Human Lung Tissue, Observed Staining: Cytoplasmic in alveolar type I & II cells, Primary Antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.
WB Suggested Anti-BCKDHA Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: MCF7 cell lysate. BCKDHA is supported by BioGPS gene expression data to be expressed in MCF7.
WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, WB | |
Mouse, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC, WB | |
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish | |
Rabbit | |
Polyclonal | |
HRP |
IHC, WB | |
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish | |
Rabbit | |
Polyclonal | |
FITC |