Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Page Not Found
Cart summary

You have no items in your shopping cart.

BBS9 Rabbit Polyclonal Antibody

SKU: orb586375

Description

BBS9 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of BBS9. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the N-terminal region of Human BBS9. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Images & Validation

Tested ApplicationsWB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N-terminal region of Human BBS9
TargetBBS9
Protein SequenceSynthetic peptide located within the following region: TDSFLTVSSCQQVESYKYQVLAFATDADKRQETEQQKLGSGKRLVVDWTL
Molecular Weight99 kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

B1, D1, C18, PTHB1

Similar Products

  • BBS9 Rabbit Polyclonal Antibody [orb1152371]

    ELISA,  FC,  IHC,  WB

    Human, Monkey, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • BBS9 Rabbit Polyclonal Antibody [orb155801]

    IF,  IHC-Fr,  IHC-P,  WB

    Canine, Equine, Human, Porcine, Rabbit, Sheep

    Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • BBS9 Rabbit Polyclonal Antibody [orb625070]

    ELISA,  IF,  IHC,  IP,  WB

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
  • PTHB1 Antibody (C-term) [orb165250]

    WB

    Human

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl
  • BBS9 Rabbit Polyclonal Antibody (HRP) [orb482494]

    IHC-Fr,  IHC-P,  WB

    Canine, Equine, Human, Porcine, Rabbit, Sheep

    Mouse, Rat

    Rabbit

    Polyclonal

    HRP

    100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

BBS9 Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell extracts was loaded onto a 6-18% SDS-PAGE gel. 2 ug/ml of the antibody was used in this experiment. The peptide sequence is present in a 85 and 80 kDa isoforms.

BBS9 Rabbit Polyclonal Antibody

WB Suggested Anti-BBS9 Antibody, Titration: 1.0 ug/ml, Positive Control: Jurkat Whole Cell.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_055266

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

BBS9 Rabbit Polyclonal Antibody (orb586375)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry