BBS9 Rabbit Polyclonal Antibody

• Catalog Number: orb586375
• Category: Antibodies
• Description: Rabbit polyclonal antibody to BBS9
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human BBS9
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 99 kDa
• Target: BBS9
• UniProt ID: Q3SYG4
• Protein Sequence: Synthetic peptide located within the following region: TDSFLTVSSCQQVESYKYQVLAFATDADKRQETEQQKLGSGKRLVVDWTL
• NCBI: NP_055266
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: B1, D1, C18, PTHB1
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 6-18% SDS-PAGE gel. 2 ug/ml of the antibody was used in this experiment. The peptide sequence is present in a 85 and 80 kDa isoforms.

WB Suggested Anti-BBS9 Antibody, Titration: 1.0 ug/ml, Positive Control: Jurkat Whole Cell.