ATP1B1 Rabbit Polyclonal Antibody

• Catalog Number: orb330385
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ATP1B1
• Target: ATP1B1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human, Rat
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Sheep
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ATP1B1
• Protein Sequence: Synthetic peptide located within the following region: VMKYNPNVLPVQCTGKRDEDKDKVGNVEYFGLGNSPGFPLQYYPYYGKLL
• UniProt ID: P05026
• MW: 35kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti ATP1B antibody, anti MGC1798 antibody
• Note: For research use only
• NCBI: NP_001001787

Sample Tissue: Rat Brain, Antibody Dilution: 1 ug/mL.

Human Heart

WB Suggested Anti-ATP1B1 Antibody Titration: 0.25 ug/mL, Positive Control: HepG2 cell lysate, ATP1B1 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells.