You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb330384 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to ATP1B1 |
Target | ATP1B1 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Sheep |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human ATP1B1 |
Protein Sequence | Synthetic peptide located within the following region: RVAPPGLTQIPQIQKTEISFRPNDPKSYEAYVLNIVRFLEKYKDSAQRDD |
UniProt ID | A6NGH2 |
MW | 35kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | anti ATP1B antibody, anti MGC1798 antibody |
Note | For research use only |
NCBI | NP_001001787 |
Rabbit Anti-ATP1B1 Antibody, Catalog Number: orb330384, Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue, Observed Staining: Plasma membrane in intercalated disk, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5 - 2.0 sec.
WB Suggested Anti-ATP1B1 Antibody Titration: 0.2-1 ug/mL, Positive Control: OVCAR-3 cell lysate.
IHC, WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Sheep | |
Human, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IH, WB | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Sheep, Zebrafish | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |