ATP1B1 Rabbit Polyclonal Antibody

• Catalog Number: orb330386
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ATP1B1
• Target: ATP1B1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Sheep, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human ATP1B1
• Protein Sequence: Synthetic peptide located within the following region: KYLQPLLAVQFTNLTMDTEIRIECKAYGENIGYSEKDRFQGRFDVKIEVK
• UniProt ID: P05026
• MW: 33kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti ATP1B1 antibody, anti ATP1B antibody, anti an
• Note: For research use only

Sample Type: Thymus Tumor lysates, Antibody Dilution: 1.0 ug/mL.

Rabbit Anti-ATP1B1 Antibody, Catalog Number: orb330386, Formalin Fixed Paraffin Embedded Tissue: Human Liver Tissue, Observed Staining: Plasma membrane and cytoplasm in hepatocytes, Primary Antibody Concentration: 1:100, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5 - 2.0 sec.