ATP1a1 Antibody

SKU: orb611198

Description

Goat polyclonal antibody to ATP1a1. Na+/K+ -ATPase is composed of two subunits, a large catalytic subunit (alpha) and a smaller glycoprotein subunit (beta). This protein is an integral membrane protein responsible for establishing and maintaining the electrochemical gradients of Na and K ions across the plasma membrane.

Research Area

Neuroscience

Images & Validation

• Tested Applications: IHC-Fr, IHC-P, WB
• Dilution Range: WB:1:500-1:2,000, IHC-P:1:250-1:1,000, IHC-F:1:250-1:1,000
• Reactivity: Bovine, Canine, Donkey, Equine, Feline, Gallus, Goat, Guinea pig, Hamster, Human, Mouse, Other, Porcine, Primate, Rabbit, Rat, Sheep
• Application Notes:
  The antibody solution should be gently mixed before use.

Key Properties

• Host: Goat
• Clonality: Polyclonal
• Isotype: IgG
• Immunogen: Antigen: Purified recombinant peptide derived from within residues 100 aa to N-terminus of human ATP1a1 produced in E. coli. Antigen Sequence: MGKGVGRDKYEPAAVSEQGDKKGKKGKKDRDMDELKKEVSMDDHKLSLDELHRKYGTDLSRGLTSARAAEILARDGPNALTPPPTTPEWIKFCRQLFGG
• Target: ATPase Na+/K+ transporting subunit alpha 1
• Purification: Epitope affinity purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Form/Appearance: Polyclonal antibody supplied as a 100 µl (3 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.
• Concentration: 1 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

ATPase Na+/K+ transporting subunit alpha 1and CMT2DD antibody.

Quick Database Links

Gene Symbol

ATPase Na+/K+ transporting subunit alpha 1