Atf4 Rabbit Polyclonal Antibody

• Catalog Number: orb576510
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Atf4
• Target: Atf4
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Mouse
• Predicted Reactivity: Bovine, Canine, Guinea pig, Human, Rat, Sheep
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse
• Protein Sequence: Synthetic peptide located within the following region: VLAGDLMSPFDQSGLGAEESLGLLDDYLEVAKHLKPHGFSSDKAGSSEWP
• UniProt ID: Q5U4B2
• MW: 38kDa
• Tested applications: IHC-P, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: Atf-, C/AT, CREB, Atf-4, C/ATF, CREB2, CREB-2, TAX
• Research Area: Cell Biology, Epigenetics & Chromatin
• Note: For research use only
• NCBI: NP_033846
• Expiration Date: 12 months from date of receipt.

Anti-ATF4 antibody IHC of human small intestine. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.

Atf4 antibody - N-terminal region (orb576510) validated by WB using Mouse Kidney at 0.2-1 ug/ml.

Sample Tissue: Mouse Kidney, Antibody Dilution: 1 ug/ml.

Sample Tissue: Mouse Kidney, Antibody Dilution: 1 ug/ml.

WB Suggested Anti-Atf4 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Mouse Kidney.