You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb576180 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to ATF4 |
Target | ATF4 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human, Mouse |
Predicted Reactivity | Mouse |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of mouse ATF4 |
Protein Sequence | Synthetic peptide located within the following region: MALFTKSSSSVAVTDKDTFELSTFLESSKAPQHDRDELPEQRSVGGGLDD |
UniProt ID | Q61328 |
MW | 42kDa |
Tested applications | IHC, WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | Atf-, C/AT, CREB, Atf-4, C/ATF, CREB2, CREB-2, TAX Read more... |
Note | For research use only |
NCBI | NP_033846 |
Sample Tissue: Mouse Brain, Antibody Dilution: 1 ug/ml.
Sample Tissue: Mouse Brain, Antibody Dilution: 1 ug/ml.
Sample Tissue: Mouse Skeletal Muscle, Antibody Dilution: 3 ug/ml.
Immunohistochemistry with Human Braun, cerebellum tissue at an antibody concentration of 5.0 ug/ml using anti-ATF4 antibody (orb576180).
Rabbit Anti-ATF4 Antibody, Catalog Number: orb576180, Formalin Fixed Paraffin Embedded Tissue: Human Bone Marrow Tissue, Observed Staining: Cytoplasm, Nucleus, Primary Antibody Concentration: 1:600, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.
WB Suggested Anti-ATF4 Antibody Titration: 0.125 ug/ml, ELISA Titer: 1:62500, Positive Control: NIH/3T3 cell lysate.
FC, ICC, IF, IHC-Fr, IHC-P, WB | |
Bovine, Canine, Equine, Porcine, Rabbit, Sheep | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IH, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC-P, WB | |
Bovine, Canine, Guinea pig, Human, Rat, Sheep | |
Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, WB | |
Bovine, Canine, Equine, Guinea pig, Human, Rat, Sheep | |
Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
PLA, WB | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |