You have no items in your shopping cart.
Featured
Description
Research Area
Epigenetics & Chromatin, Neuroscience, Signal Transduction
Images & Validation
−| Tested Applications | ICC, IF, IHC, IP, WB |
|---|---|
| Dilution Range | WB (1:1000), ICC/IF (1:100) |
| Reactivity | Human, Mouse, Rat |
| Application Notes |
Key Properties
−| Host | Mouse |
|---|---|
| Clonality | Monoclonal |
| Isotype | IgG2b |
| Clone No. | N76/8 (Formerly sold as S76-8) |
| Immunogen | Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). |
| Target | Ataxin 1 |
| Molecular Weight | 85kDa |
| Purification | Protein G Purified |
| Conjugation | Biotin |
Storage & Handling
−| Storage | Conjugated antibodies should be stored according to the product label |
|---|---|
| Buffer/Preservatives | 136.36mM Ethanolamine, 133.23 mM Chlorides, 9.55mM Phosphates, 9.55mM Sodium Bicarbonate |
| Concentration | 1 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Ataxin 1, Ataxin-1, ATX1, Atxn1, D6S504E, OTTHUMP00000016065, SCA1, Spinocerebellar ataxia type 1 protein
Similar Products
−
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt Details
− No UniProt data available
NCBI Gene Details
− No NCBI Gene data available
NCBI Reference Sequences
−Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product| Protein | NP_001186233.1 |
|---|
Protocol Information
WB
Western Blot (IB, immunoblot)
IHC
Immunohistochemistry
IF
Immunofluorescence
ICC
Immunocytochemistry
IP
Immunoprecipitation





