ARHGEF9 Rabbit Polyclonal Antibody

• Catalog Number: orb589025
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ARHGEF9
• Target: ARHGEF9
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Mouse
• Predicted Reactivity: Mouse
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity purified
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of mouse ARHGEF9
• Protein Sequence: Synthetic peptide located within the following region: KRQAAMTVRKASKQKGVNSARSVPPSYPPPQDPLNQGQYLVPDGIAQSQV
• UniProt ID: A0A0G2JEH1
• MW: 55 kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: coll, 9630036L12Rik
• Note: For research use only
• NCBI: NP_001166950.1
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Mouse Heart lysates, Antibody Dilution: 1.0 ug/ml.