AQP1 Antibody

SKU: orb1176907

Description

Rabbit polyclonal antibody to AQP1

Research Area

Kidney & Urological Research

Images & Validation

• Tested Applications: IHC-P, WB
• Dilution Range: Western blot: 0.1-0.5μg/ml. Immunohistochemistry(Paraffin-embedded Section): 0.5-1μg/ml
• Reactivity: Human, Mouse, Rat

Key Properties

• Clonality: Polyclonal
• Isotype: IgG
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Aquaporin 1 (240-269aa DRVKVWTSGQVEEYDLDADDINSRVEMKPK), different from the related mouse and rat sequences by one amino acid.
• Target: AQP1
• Purification: Immunogen affinity purified.
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Form/Appearance: Lyophilized
• Buffer/Preservatives: Antibody is lyophilized with 5 mg rAlbumin, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

AQP 1 antibody, AQP CHIP antibody, AQP-1 antibody, AQP1 antibody, AQP1_ HUMAN antibody, Aquaporin CHIP antibody, Aquaporin-1 antibody, Aquaporin-CHIP antibody, Aquaporin1 antibody, Channel forming integral protein 28kDa antibody, Channel like integral membrane protein 28 kDa antibody, CHIP 28 antibody, CHIP28 antibody, CO antibody, Colton blood group antibody, Growth factor induced delayed early response protein antibody, MGC26324 antibody, Urine water channel antibody, Water channel protein CHIP 29 antibody, Water channel protein CHIP29 antibody, Water channel protein for red blood cells and kidney proximal tubule antibody

Quick Database Links

Gene Symbol

AQP1