APOBEC3G antibody

• Catalog Number: orb329731
• Category: Antibodies
• Description: Rabbit polyclonal antibody to APOBEC3G
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Human, Porcine
• Reactivity: Human, Porcine
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human APOBEC3G
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 46kDa
• Target: APOBEC3G
• UniProt ID: Q9HC16
• Protein Sequence: Synthetic peptide located within the following region: AKIFRGQVYSELKYHPEMRFFHWFSKWRKLHRDQEYEVTWYISWSPCTKC
• NCBI: NP_068594
• Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti ARCD antibody, anti ARP9 antibody, anti ARP-9
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western blot analysis of human Daudi tissue using APOBEC3G antibody