APOBEC3G Rabbit Polyclonal Antibody

• Catalog Number: orb329730
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ASGR2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Porcine
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human APOBEC3G
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 46kDa
• Target: APOBEC3G
• UniProt ID: Q9HC16
• Protein Sequence: Synthetic peptide located within the following region: AKIFRGQVYSELKYHPEMRFFHWFSKWRKLHRDQEYEVTWYISWSPCTKC
• NCBI: NP_068594
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti HL-2 antibody, anti HBXBP antibody, anti ASGP
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Human Stomach

Rabbit Anti-ASGR2 Antibody, Catalog Number: orb329730, Formalin Fixed Paraffin Embedded Tissue: Human Liver Tissue, Observed Staining: Plasma membrane in endothelial cells in lymphatic vessel, Primary Antibody Concentration: 1:100, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5 - 2.0 sec.

WB Suggested Anti-APOBEC3G Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:1562500, Positive Control: Daudi cell lysate.