C13ORF8 Rabbit Polyclonal Antibody

• Catalog Number: orb324392
• Category: Antibodies
• Description: Rabbit polyclonal antibody to APOBEC3G
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Canine, Equine, Mouse, Porcine, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C13ORF8
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 89kDa
• Target: APOBEC3G
• UniProt ID: Q96JM3
• Protein Sequence: Synthetic peptide located within the following region: PAASPESRKSARTTSPEPRKPSPSESPEPWKPFPAVSPEPRRPAPAVSPG
• NCBI: NP_115812
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti ARCD antibody, anti ARP9 antibody, anti ARP-9
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

HumanMuscle

WB Suggested Anti-C13ORF8 Antibody Titration: 1.0 ug/mL, ELISA Titer: 1:62500, Positive Control: Daudi cell lysate, APOBEC3G is strongly supported by BioGPS gene expression data to be expressed in Human Daudi cells.