AKR1E2 Rabbit Polyclonal Antibody

• Catalog Number: orb585481
• Category: Antibodies
• Description: Rabbit polyclonal antibody to AKR1E2
• Target: AKR1E2
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Protein Sequence: Synthetic peptide located within the following region: PSHIKENIQVFDFELTQHDMDNILSLNRNLRLAMFPITKNHKDYPFHIEY
• UniProt ID: Q96JD6
• MW: 36kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: TAKR, hTSP, HTSP1, htAKR, AKRDC1, AKR1CL2, LoopADR
• Research Area: Immunology & Inflammation, Stem Cell & Development
• Note: For research use only
• NCBI: NP_001035267
• Expiration Date: 12 months from date of receipt.

WB Suggested Anti-AKR1E2 Antibody, Titration: 1.0 ug/ml, Positive Control: Fetal Lung.