AIFM1 Rabbit Polyclonal Antibody

• Catalog Number: orb592665
• Category: Antibodies
• Description: Rabbit polyclonal antibody to AIFM1
• Target: AIFM1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human, Mouse, Rat
• Predicted Reactivity: Bovine, Canine, Equine, Porcine, Rabbit
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human AIFM1
• Protein Sequence: Synthetic peptide located within the following region: VIFYLRDKVVVGIVLWNIFNRMPIARKIIKDGEQHEDLNEVAKLFNIHED
• UniProt ID: O95831
• MW: 67kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: AIF, AUNX1, CMT2D, CMTX4, COWCK, DFNX5, NADMR, NAM
• Note: For research use only
• NCBI: NP_004199

Sample Tissue: Mouse Heart, Antibody Dilution: 1 ug/ml.

Sample Tissue: Mouse Heart, Antibody Dilution: 1 ug/ml.

WB Suggested Anti-AIFM1 Antibody, Titration: 1 ug/ml, Positive Control: Rat tissue.

WB Suggested Anti-AIFM1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: Jurkat cell lysate. AIFM1 is supported by BioGPS gene expression data to be expressed in Jurkat.