PDCD8 Rabbit Polyclonal Antibody

• Catalog Number: orb324833
• Category: Antibodies
• Description: Rabbit polyclonal antibody to AIFM1
• Target: AIFM1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human, Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Porcine, Rabbit, Rat, Sheep, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human PDCD8
• Protein Sequence: Synthetic peptide located within the following region: VDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEASEITIPPST
• UniProt ID: O95831
• MW: 36kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti AIF antibody, anti PDCD8 antibody, anti COXPD
• Research Area: Cell Biology, Epigenetics & Chromatin
• Note: For research use only
• NCBI: NP_665812

AIFM1 was immunoprecipitated from 2 mg HEK293 Whole Cell Lysate with orb324833 with 1:200 dilution. Western blot was performed using orb324833 at 1/1000 dilution, Lane 1: Control IP in HEK293 Whole Cell Lysate, Lane 2: AIFM1 IP with orb324833 in HEK293 Whole Cell Lysate, Lane 3: Input of HEK293 Whole Cell Lysate.

Sample Tissue: Mouse Liver, Antibody Dilution: 1 ug/mL.

Sample Tissue: Mouse Liver, Antibody Dilution: 1 ug/mL.

Rabbit Anti-AIFM1 Antibody, Catalog Number: orb324833, Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue, Observed Staining: Cytoplasmic, nucleus, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5 - 2.0 sec.

Rabbit Anti-AIFM1 Antibody, Catalog Number: orb324833, Formalin Fixed Paraffin Embedded Tissue: Human Kidney Tissue, Observed Staining: Cytoplasm, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5 - 2.0 sec.

WB Suggested Anti-PDCD8 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: Jurkat cell lysate, AIFM1 is supported by BioGPS gene expression data to be expressed in Jurkat.