4930567H17Rik Rabbit Polyclonal Antibody

SKU: orb324377

Description

4930567H17Rik Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody targeting 4930567H17Rik. It is suitable for WB and is reactive with mouse samples. Predicted reactivity includes Bovine, Canine, Equine, Human, Porcine, Rabbit, Rat, Yeast, Zebrafish. This antibody is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cell Biology, Epigenetics & Chromatin, Molecular Biology, Stem Cell & Developmental Biology

Images & Validation

• Tested Applications: WB
• Reactivity: Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Human, Porcine, Rabbit, Rat, Yeast, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Target: 4930567H17Rik
• Protein Sequence: Synthetic peptide located within the following region: TLSSYDPCRYILKAALSVITAWENTLEEEEEDEEEDEEEEEMEEEDEGEE
• Molecular Weight: 27kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Quick Database Links

Gene Symbol

4930567H17Rik

UniProt

Q3V0K5

RefSeq (Protein):NP_001028979