ZO1 Antibody

• Catalog Number: orb153344
• Category: Antibodies
• Description: Goat polyclonal to TJP1 tight junction protein 1 (TJP1). TJP1 is located on a cytoplasmic membrane surface of intercellular tight junctions and may be involved in signal transduction at cell-cell junctions.
• Target: Tight junction protein 1
• Clonality: Polyclonal
• Species/Host: Goat
• Isotype: IgG
• Conjugation: Unconjugated
• Reactivity: Bovine, Canine, Donkey, Equine, Feline, Gallus, Goat, Guinea pig, Hamster, Human, Mouse, Other, Porcine, Primate, Rabbit, Rat, Sheep
• Concentration: 1 mg/ml
• Buffer/Preservatives: PBS, 20% glycerol and 0.05% sodium azide
• Immunogen: Antigen: Purified recombinant peptide derived from within residues 1580 aa to the C-terminus of human ZO-1 produced in E. coli.. Antigen Sequence: PQGAIPEGVEQEIYFKVCRDNSILPPLDKEKGETLLSPLVMCGPHGLKFLKPVELRLPHCDPKTWQNKCLPGDPNYLVGANCVSVLIDHF
• Tested applications: IF, IHC-Fr, IHC-P, WB
• Dilution range: WB:1:500-1:2,000, IF:1:50-1:250, IHC-P:1:50-1:200, IHC-F:1:50-1:200
• Application notes: The antibody solution should be gently mixed before use.
• Antibody Type: Primary Antibody
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: ZO-1 and zona occludens protein 1 antibody.
• Note: For research use only

References

Ting-Ting Yang # 1, Ying Liu # 1, Yu-Ting Shao # 1, Lin Li 2, Dan-Dan Pan 1, Tao Wang 3, Zhen-Zhou Jiang 4, Bao-Jing Li 5, Si-Tong Qian 1, Meng Yan 1, Xia Zhu 1, Cai Heng 6, Jun-Jie Liu 7 8, Qian Lu 9, Xiao-Xing Yin Activation of MST1 protects filtration barrier integrity of diabetic kidney disease in mice through restoring the tight junctions of glomerular endothelial cells Acta Pharmacol Sin, (2024)

PubMed: 39643641

Reinhold, Ann Kristin et al. MicroRNA-21-5p functions via RECK/MMP9 as a proalgesic regulator of the blood nerve barrier in nerve injury Ann N Y Acad Sci, (2022)

PubMed: 35716075

Immunohistochemical analysis of mouse kidney tissue using ZO-1 antibody.

immunofluoroscence analysis of RPE cells using ZO-1 antibody.

Western blot analysis of using ZO-1 antibody.

Immunofluoroscence analysis of RPE cells using ZO-1 antibody.

Immunohistochemical analysis of human pancreas using ZO-1 antibody.

Immunofluoroscence analysis of RPE cells using ZO-1 antibody.

Immunohistochemical analysis of human pancreas using ZO-1 antibody.

Immunofluoroscence analysis of RPE cells using ZO-1 antibody.

Immunohistochemical analysis of mouse kidney using ZO-1 antibody.

Immunofluoroscence analysis of RPE cells using ZO-1 antibody.