You have no items in your shopping cart.
ZO1 Antibody
Description
Images & Validation
−| Tested Applications | IF, IHC-Fr, IHC-P, WB |
|---|---|
| Dilution Range | WB:1:500-1:2,000, IF:1:50-1:250, IHC-P:1:50-1:200, IHC-F:1:50-1:200 |
| Reactivity | Canine, Human, Monkey, Mouse, Rat |
| Application Notes |
Key Properties
−| Antibody Type | Primary Antibody |
|---|---|
| Host | Goat |
| Clonality | Polyclonal |
| Isotype | IgG |
| Immunogen | Antigen: Purified recombinant peptide derived from within residues 1580 aa to the C-terminus of human ZO-1 produced in E. coli.. Antigen Sequence: PQGAIPEGVEQEIYFKVCRDNSILPPLDKEKGETLLSPLVMCGPHGLKFLKPVELRLPHCDPKTWQNKCLPGDPNYLVGANCVSVLIDHF |
| Target | Tight junction protein 1 |
| Purification | Epitope affinity purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | PBS, 20% glycerol and 0.05% sodium azide |
| Concentration | 1 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−DBPA Rabbit Polyclonal Antibody [orb156545]
IF, IHC-Fr, IHC-P, WB
Bovine, Canine, Porcine, Rabbit, Sheep
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
200 μl, 100 μl, 50 μlZO-1 antibody [N1N2], N-term [orb556551]
ICC, IHC-Fr, IP, WB
Fish, Human, Mouse
Rabbit
Polyclonal
Unconjugated
100 μlZO-1/TJP1 Rabbit Polyclonal Antibody [orb499587]
FC, ICC, WB
Human
Human
Rabbit
Polyclonal
Unconjugated
200 μl, 50 μl, 100 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Immunohistochemical analysis of mouse kidney tissue using ZO-1 antibody.

immunofluoroscence analysis of RPE cells using ZO-1 antibody.

Western blot analysis of using ZO-1 antibody.

Immunofluoroscence analysis of RPE cells using ZO-1 antibody.

Immunohistochemical analysis of human pancreas using ZO-1 antibody.

Immunofluoroscence analysis of RPE cells using ZO-1 antibody.

Immunohistochemical analysis of human pancreas using ZO-1 antibody.

Immunofluoroscence analysis of RPE cells using ZO-1 antibody.

Immunohistochemical analysis of mouse kidney using ZO-1 antibody.

Immunofluoroscence analysis of RPE cells using ZO-1 antibody.
Quick Database Links
Documents Download
Request a Document
Protocol Information
Ting-Ting Yang # 1, Ying Liu # 1, Yu-Ting Shao # 1, Lin Li 2, Dan-Dan Pan 1, Tao Wang 3, Zhen-Zhou Jiang 4, Bao-Jing Li 5, Si-Tong Qian 1, Meng Yan 1, Xia Zhu 1, Cai Heng 6, Jun-Jie Liu 7 8, Qian Lu 9, Xiao-Xing Yin Activation of MST1 protects filtration barrier integrity of diabetic kidney disease in mice through restoring the tight junctions of glomerular endothelial cells Acta Pharmacol Sin, (2024)
Reinhold, Ann Kristin et al. MicroRNA-21-5p functions via RECK/MMP9 as a proalgesic regulator of the blood nerve barrier in nerve injury Ann N Y Acad Sci, (2022)
ZO1 Antibody (orb153344)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review
































![ZO-1 antibody [N1N2], N-term](/images/pub/media/catalog/product/z/o/zo1-antibody_orb556551_if_1.jpg)
![ZO-1 antibody [N1N2], N-term](/images/pub/media/catalog/product/z/o/zo1-antibody_orb556551_ihc_1.jpg)
![ZO-1 antibody [N1N2], N-term](/images/pub/media/catalog/product/z/o/zo1-antibody_orb556551_ihc-p_1.jpg)
![ZO-1 antibody [N1N2], N-term](/images/pub/media/catalog/product/z/o/zo1-antibody_orb556551_ihc-p_2.jpg)
![ZO-1 antibody [N1N2], N-term](/images/pub/media/catalog/product/z/o/zo1-antibody_orb556551_wb_1.jpg)
![ZO-1 antibody [N1N2], N-term](/images/pub/media/catalog/product/z/o/zo1-antibody_orb556551_wb_2.jpg)
![ZO-1 antibody [N1N2], N-term](/images/pub/media/catalog/product/z/o/zo1-antibody_orb556551_wb_3.jpg)



