Cart summary

You have no items in your shopping cart.

ZNF84 Rabbit Polyclonal Antibody (FITC)

ZNF84 Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2133160

DispatchUsually dispatched within 5-10 working days
$ 620.00
Catalog Numberorb2133160
CategoryAntibodies
DescriptionZNF84 Rabbit Polyclonal Antibody (FITC)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsIHC, WB
Predicted ReactivityBovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human ZNF84
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationFITC
MW85kDa
UniProt IDP51523
Protein SequenceSynthetic peptide located within the following region: RKAFSQKSQLVNHQRIHTGEKPYRCIECGKAFSQKSQLINHQRTHTVKKS
NCBINP_003419
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesHPF2
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.