Cart summary

You have no items in your shopping cart.

ZNF84 Rabbit Polyclonal Antibody (Biotin)

ZNF84 Rabbit Polyclonal Antibody (Biotin)

Catalog Number: orb2133158

Select Product Size
SizePriceQuantity
100 μl$ 0.00
100 μl Enquire
DispatchUsually dispatched within 5-10 working days
Product Properties
Catalog Numberorb2133158
CategoryAntibodies
DescriptionZNF84 Rabbit Polyclonal Antibody (Biotin)
ClonalityPolyclonal
Species/HostRabbit
ConjugationBiotin
Predicted ReactivityBovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human ZNF84
Protein SequenceSynthetic peptide located within the following region: RKAFSQKSQLVNHQRIHTGEKPYRCIECGKAFSQKSQLINHQRTHTVKKS
UniProt IDP51523
MW85kDa
Tested applicationsIHC, WB
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Alternative namesHPF2
NoteFor research use only
NCBINP_003419
Images
Similar Products
Reviews

ZNF84 Rabbit Polyclonal Antibody (Biotin) (orb2133158)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet