You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb324625 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to ZNF695 |
Target | ZNF695 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Human |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 1.0 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human SBZF3 |
Protein Sequence | Synthetic peptide located within the following region: FNMQFLFHSLAMSKPELIICLEARKEPWNVNTEKTAKHSALSSYLTEDIL |
UniProt ID | Q9HD74 |
MW | 54kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | anti SBZF3 antibody, anti RP11-551G24.1 antibody |
Note | For research use only |
WB Suggested Anti-SBZF3 Antibody Titration: 1.25 ug/mL, ELISA Titer: 1:1562500, Positive Control: HepG2 cell lysate.