You have no items in your shopping cart.
Description
Research Area
Epigenetics & Chromatin
Images & Validation
−Item 1 of 1
| Tested Applications | WB |
|---|---|
| Reactivity | Human |
| Predicted Reactivity | Human |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human SBZF3 |
| Target | ZNF695 |
| Protein Sequence | Synthetic peptide located within the following region: FNMQFLFHSLAMSKPELIICLEARKEPWNVNTEKTAKHSALSSYLTEDIL |
| Molecular Weight | 54kDa |
| Purification | Protein A purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 1.0 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−anti SBZF3 antibody, anti RP11-551G24.1 antibody
Similar Products
−- Item 1 of 1
ZNF695 rabbit pAb Antibody [orb769744]
ELISA, WB
Human, Mouse, Rat
Polyclonal
Unconjugated
100 μl, 50 μl - Item 1 of 1
- Item 1 of 1
- Item 1 of 1
- Item 1 of 1
ZNF695 Rabbit Polyclonal Antibody [orb315748]
WB
Human
Rabbit
Polyclonal
Unconjugated
30 μl, 100 μl, 200 μl, 50 μl
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
WB Suggested Anti-SBZF3 Antibody Titration: 1.25 ug/mL, ELISA Titer: 1:1562500, Positive Control: HepG2 cell lysate.
Quick Database Links
Gene Symbol
ZNF695
UniProt
UniProt Details
− No UniProt data available
Documents Download
Datasheet
Product Information
Request a Document
SBZF3 Rabbit Polyclonal Antibody (orb324625)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a ReviewAvailable Sizes
Select a size below
Free Secondary Antibody (20 ul)0/0
Please add an antibody product to your cart first.
Usually dispatched within 1 - 2 weeks