You have no items in your shopping cart.
Cart summary
Item 1 of 1
SBZF3 Rabbit Polyclonal Antibody
Catalog Number: orb324625
| Catalog Number | orb324625 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to ZNF695 |
| Target | ZNF695 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Human |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 1.0 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human SBZF3 |
| Protein Sequence | Synthetic peptide located within the following region: FNMQFLFHSLAMSKPELIICLEARKEPWNVNTEKTAKHSALSSYLTEDIL |
| UniProt ID | Q9HD74 |
| MW | 54kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | anti SBZF3 antibody, anti RP11-551G24.1 antibody |
| Note | For research use only |
WB Suggested Anti-SBZF3 Antibody Titration: 1.25 ug/mL, ELISA Titer: 1:1562500, Positive Control: HepG2 cell lysate.
- Item 1 of 1
- Item 1 of 1
- Item 1 of 1
- Item 1 of 1
- Item 1 of 1
