ZNF274 Rabbit Polyclonal Antibody

• Catalog Number: orb577295
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ZNF274
• Target: ZNF274
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Human
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ZNF274
• Protein Sequence: Synthetic peptide located within the following region: SHLIRHQRTHTGERPYACNKCGKAFTQSSHLIGHQRTHNRTKRKKKQPTS
• UniProt ID: Q96GC6
• MW: 62kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: ZF2, HFB101, ZSCAN51, ZKSCAN19
• Research Area: Epigenetics & Chromatin, Signal Transduction
• Note: For research use only
• NCBI: NP_057408

Rabbit Anti-ZNF274 antibody, Paraffin Embedded Tissue: Human Lung, cell Cellular Data: alveolar cell, Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X.

WB Suggested Anti-ZNF274 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: MCF7 cell lysate. ZNF274 is supported by BioGPS gene expression data to be expressed in MCF7.