You have no items in your shopping cart.
Cart summary
Item 1 of 3
Item 1 of 3
ZNF274 Rabbit Polyclonal Antibody
Catalog Number: orb573826
| Catalog Number | orb573826 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to ZNF274 |
| Species/Host | Rabbit |
| Clonality | Polyclonal |
| Tested applications | IHC, WB |
| Predicted Reactivity | Bovine, Canine, Mouse, Porcine, Rabbit, Rat |
| Reactivity | Human |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF274 |
| Concentration | 1.0 mg/ml |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Conjugation | Unconjugated |
| MW | 62kDa |
| Target | ZNF274 |
| UniProt ID | Q96GC6 |
| Protein Sequence | Synthetic peptide located within the following region: YPELQLDPKLDPLPAESPLMNIEVVEVLTLNQEVAGPRNAQIQALYAEDG |
| NCBI | NP_057408 |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Alternative names | ZF2, HFB101, ZSCAN51, ZKSCAN19 Read more... |
| Note | For research use only |
| Expiration Date | 12 months from date of receipt. |
Human Heart
Human kidney
WB Suggested Anti-ZNF274 Antibody Titration: 2.5 ug/ml, ELISA Titer: 1:312500, Positive Control: Jurkat cell lysate.
- Item 1 of 2
- Item 1 of 1
- Item 1 of 2
ZNF274 Rabbit Polyclonal Antibody [orb78384]
ELISA, IHC, WB
Mouse, Rat
Human
Rabbit
Polyclonal
Unconjugated
100 μg - Item 1 of 1
