ZNF133 Rabbit Polyclonal Antibody

• Catalog Number: orb576628
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ZNF133
• Target: ZNF133
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human, Mouse
• Predicted Reactivity: Porcine, Rabbit
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ZNF133
• Protein Sequence: Synthetic peptide located within the following region: KPYVCKTCGRGFSLKSHLSRHRKTTSVHHRLPVQPDPEPCAGQPSDSLYS
• UniProt ID: Q53XU1
• MW: 73kDa
• Tested applications: IF, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: ZNF150, pHZ-13, pHZ-66
• Research Area: Epigenetics & Chromatin
• Note: For research use only
• NCBI: NP_003425

Three cryosections on each slide were stained with a single antibody. The fourth slice was used as a negative control (primary antibody omitted). The tissue was fixed with cold acetone for 10 minutes, rinsed in phosphate buffered saline (PBS) and incubated with the primary antibody diluted in 1% bovine serum albumin (BSA) in PBS for 1 hour at room temperature. Rabbit anti human antibodies and dilutions used:e) ZNF133 (38332), most suitable concentration 1:100.

WB Suggested Anti-ZNF133 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: THP-1 cell lysate.