You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb576628 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to ZNF133 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IF, WB |
Predicted Reactivity | Porcine, Rabbit |
Reactivity | Human, Mouse |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human ZNF133 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 73kDa |
Target | ZNF133 |
UniProt ID | Q53XU1 |
Protein Sequence | Synthetic peptide located within the following region: KPYVCKTCGRGFSLKSHLSRHRKTTSVHHRLPVQPDPEPCAGQPSDSLYS |
NCBI | NP_003425 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | ZNF150, pHZ-13, pHZ-66 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Three cryosections on each slide were stained with a single antibody. The fourth slice was used as a negative control (primary antibody omitted). The tissue was fixed with cold acetone for 10 minutes, rinsed in phosphate buffered saline (PBS) and incubated with the primary antibody diluted in 1% bovine serum albumin (BSA) in PBS for 1 hour at room temperature. Rabbit anti human antibodies and dilutions used:e) ZNF133 (38332), most suitable concentration 1:100.
WB Suggested Anti-ZNF133 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: THP-1 cell lysate.
IF, WB | |
Equine, Porcine, Rabbit | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Mouse, Porcine, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Porcine, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |