You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb575577 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to ZNF133 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IF, WB |
Predicted Reactivity | Equine, Porcine, Rabbit |
Reactivity | Human, Mouse |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF133 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 73kDa |
Target | ZNF133 |
UniProt ID | Q53XU1 |
Protein Sequence | Synthetic peptide located within the following region: LRGVELEASPAQTGNPEETDKLLKRIEVLGFGTVNCGECGLSFSKMTNLL |
NCBI | NP_003425 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | ZNF150, pHZ-13, pHZ-66 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
WB Suggested Anti-DPYS (dihydropyrimidinase) Antibody (Clone #:8B11)(100 ug), Titration: 0.5 ug/ml, Positive Control: Fetal Liver.
WB Suggested Anti-ZNF133 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: 721_B cell lysate, ZNF133 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.
IF, WB | |
Porcine, Rabbit | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Mouse, Porcine, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Porcine, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |