ZNF133 Rabbit Polyclonal Antibody

• Catalog Number: orb575577
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ZNF133
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IF, WB
• Predicted Reactivity: Equine, Porcine, Rabbit
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF133
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 73kDa
• Target: ZNF133
• UniProt ID: Q53XU1
• Protein Sequence: Synthetic peptide located within the following region: LRGVELEASPAQTGNPEETDKLLKRIEVLGFGTVNCGECGLSFSKMTNLL
• NCBI: NP_003425
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: ZNF150, pHZ-13, pHZ-66
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

WB Suggested Anti-DPYS (dihydropyrimidinase) Antibody (Clone #:8B11)(100 ug), Titration: 0.5 ug/ml, Positive Control: Fetal Liver.

WB Suggested Anti-ZNF133 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: 721_B cell lysate, ZNF133 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.