YWHAE Rabbit Polyclonal Antibody

• Catalog Number: orb573662
• Category: Antibodies
• Description: Rabbit polyclonal antibody to YWHAE
• Target: YWHAE
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Equine, Guinea pig, Mouse, Rabbit, Rat, Sheep, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Protein Sequence: Synthetic peptide located within the following region: ELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDGEEQNKEALQDVEDEN
• UniProt ID: P62258
• MW: 29kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: MDS, HEL2, MDCR, KCIP-1, 14-3-3E
• Note: For research use only
• NCBI: NP_006752

Product Page for YWHAE antibody - C-terminal region (orb573662), Sample Type: Normal Human Prostate, Primary Antibody dilution: 1 ug/ml, Color/Signal Descriptions: YWHAE (DAB; brown), nuclei (hematoxylin; blue), Gene Name: YWHAE.

Product Page for YWHAE antibody - C-terminal region (orb573662), Sample Type: Normal Human Prostate, Primary Antibody dilution: 1 ug/ml, Color/Signal Descriptions: YWHAE (DAB; brown), nuclei (hematoxylin; blue), Gene Name: YWHAE.

Product Page for YWHAE antibody - C-terminal region (orb573662), Sample Type: Normal Human Prostate, Primary Antibody dilution: 1 ug/ml, Color/Signal Descriptions: YWHAE (DAB; brown), nuclei (hematoxylin; blue), Gene Name: YWHAE.

WB Suggested Anti-YWHAE Antibody, Titration: 1.0 ug/ml, Positive Control: Placenta.