You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb573662 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to YWHAE |
Target | YWHAE |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Equine, Guinea pig, Mouse, Rabbit, Rat, Sheep, Zebrafish |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Protein Sequence | Synthetic peptide located within the following region: ELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDGEEQNKEALQDVEDEN |
UniProt ID | P62258 |
MW | 29kDa |
Tested applications | IHC, WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | MDS, HEL2, MDCR, KCIP-1, 14-3-3E |
Note | For research use only |
NCBI | NP_006752 |
Product Page for YWHAE antibody - C-terminal region (orb573662), Sample Type: Normal Human Prostate, Primary Antibody dilution: 1 ug/ml, Color/Signal Descriptions: YWHAE (DAB; brown), nuclei (hematoxylin; blue), Gene Name: YWHAE.
Product Page for YWHAE antibody - C-terminal region (orb573662), Sample Type: Normal Human Prostate, Primary Antibody dilution: 1 ug/ml, Color/Signal Descriptions: YWHAE (DAB; brown), nuclei (hematoxylin; blue), Gene Name: YWHAE.
Product Page for YWHAE antibody - C-terminal region (orb573662), Sample Type: Normal Human Prostate, Primary Antibody dilution: 1 ug/ml, Color/Signal Descriptions: YWHAE (DAB; brown), nuclei (hematoxylin; blue), Gene Name: YWHAE.
WB Suggested Anti-YWHAE Antibody, Titration: 1.0 ug/ml, Positive Control: Placenta.
IF, IHC-Fr, IHC-P, WB | |
Bovine, Gallus, Rabbit, Sheep | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IH, WB | |
Human, Mouse, Primate, Rat, Sheep, Zebrafish | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC, WB | |
Bovine, Equine, Guinea pig, Rabbit, Rat, Sheep, Zebrafish | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, FC, IF, IHC, IP, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IF, IHC-P, WB | |
Human, Mouse, Rat | |
Polyclonal | |
Unconjugated |