Cart summary

You have no items in your shopping cart.

WT1 Rabbit Polyclonal Antibody

SKU: orb329950

Description

Rabbit polyclonal antibody to WT1

Research Area

Cancer Biology, Cell Biology, Epigenetics & Chromatin, Molecular Biology, Stem Cell & Developmental Biology

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman, Mouse
Predicted ReactivityBovine, Canine, Equine, Porcine, Rabbit, Rat, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human WT1
TargetWT1
Protein SequenceSynthetic peptide located within the following region: DHLKTHTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMHQRNMTKLQLA
Molecular Weight49 kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

Anti-2310001G03Rik antibody, anti-PAR 4 antibody, anti-PAR-4 antibody, anti-Pawr antibody, anti-PAWR_HUMAN antibody, anti-PRKC Apoptosis WT1 Regulator antibody, anti-PRKC apoptosis WT1 regulator protein antibody, anti-Prostate apoptosis response 4 protein antibody, anti-Prostate apoptosis response protein 4 antibody, anti-prostate apoptosis response protein PAR-4 antibody, anti-Transcriptional repressor Par-4-like protein PAWR antibody, anti-Transcriptional repressor PAR4 antibody, anti-WT1 Interacting Protein antibody

Similar Products

  • WT1 Rabbit Polyclonal Antibody [orb1621]

    FC,  IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Gallus, Porcine, Rat, Sheep

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • PAR-4 rabbit pAb Antibody [orb766023]

    ELISA,  IF,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    100 μl, 50 μl
  • PAWR Antibody [orb685457]

    ELISA,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • PAWR Rabbit Polyclonal Antibody [orb574032]

    IHC,  WB

    Equine, Guinea pig, Mouse, Rabbit

    Human, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • WT1 transcription factor Antibody [orb555926]

    IHC-P,  WB

    Mouse, Rat, Zebrafish

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

WT1 Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment. The middle peptide is contained within multiple isoforms of this protein from 63 kDa to 33 kDa (~10 isoforms), and at least 4 of these isoforms seem represented in samples shown (63 kDa, 47-49 kDa, 40 kDa, and 33 kDa).

WT1 Rabbit Polyclonal Antibody

Sample Tissue: Mouse Brain, Antibody Dilution: 1 ug/mL.

WT1 Rabbit Polyclonal Antibody

Sample Tissue: Human Jurkat, Antibody Dilution: 1.0 ug/mL.

WT1 Rabbit Polyclonal Antibody

Human Testis

WT1 Rabbit Polyclonal Antibody

WB Suggested Anti-WT1 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:1562500, Positive Control: HT1080 cell lysate.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_077742

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

WT1 Rabbit Polyclonal Antibody (orb329950)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 600.00
DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry