Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

WT1 Rabbit Polyclonal Antibody

SKU: orb329950

Description

WT1 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of WT1. It is suitable for IHC, WB applications. The immunogen is a synthetic peptide directed towards the middle region of human WT1. This antibody reacts with Human, Mouse samples and is predicted to react with Bovine, Canine, Equine, Porcine, Rabbit, Rat, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cancer Biology

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman, Mouse
Predicted ReactivityBovine, Canine, Equine, Porcine, Rabbit, Rat, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human WT1
TargetWT1
Protein SequenceSynthetic peptide located within the following region: DHLKTHTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMHQRNMTKLQLA
Molecular Weight49 kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

Anti-2310001G03Rik antibody, anti-PAR 4 antibody, anti-PAR-4 antibody, anti-Pawr antibody, anti-PAWR_HUMAN antibody, anti-PRKC Apoptosis WT1 Regulator antibody, anti-PRKC apoptosis WT1 regulator protein antibody, anti-Prostate apoptosis response 4 protein antibody, anti-Prostate apoptosis response protein 4 antibody, anti-prostate apoptosis response protein PAR-4 antibody, anti-Transcriptional repressor Par-4-like protein PAWR antibody, anti-Transcriptional repressor PAR4 antibody, anti-WT1 Interacting Protein antibody

Similar Products

  • WT1 Rabbit Polyclonal Antibody [orb1621]

    FC,  WB

    Bovine, Canine, Gallus, Porcine, Rat, Sheep

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • WT1 Antibody (Center E361) [orb1937831]

    FC,  IF,  IHC-P,  WB

    Other, Porcine, Rat

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl
  • PAR-4 rabbit pAb Antibody [orb766023]

    ELISA,  IF,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    50 μl, 100 μl
  • WTIP Antibody (C-term) [orb1937916]

    IF,  IHC-P,  WB

    Mouse

    Human

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl
  • WT1 Rabbit Polyclonal Antibody [orb632626]

    ELISA,  IF,  IHC,  IP,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

WT1 Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment. The middle peptide is contained within multiple isoforms of this protein from 63 kDa to 33 kDa (~10 isoforms), and at least 4 of these isoforms seem represented in samples shown (63 kDa, 47-49 kDa, 40 kDa, and 33 kDa).

WT1 Rabbit Polyclonal Antibody

Sample Tissue: Mouse Brain, Antibody Dilution: 1 ug/mL.

WT1 Rabbit Polyclonal Antibody

Sample Tissue: Human Jurkat, Antibody Dilution: 1.0 ug/mL.

WT1 Rabbit Polyclonal Antibody

Human Testis

WT1 Rabbit Polyclonal Antibody

WB Suggested Anti-WT1 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:1562500, Positive Control: HT1080 cell lysate.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_077742

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

WT1 Rabbit Polyclonal Antibody (orb329950)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry