Cart summary

You have no items in your shopping cart.

WNT4 Rabbit Polyclonal Antibody

SKU: orb329646

Description

Rabbit polyclonal antibody to WNT4

Research Area

Cell Biology, Epigenetics & Chromatin, Signal Transduction, Stem Cell & Developmental Biology

Images & Validation

Tested ApplicationsWB
ReactivityHuman, Mouse
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human WNT4
TargetWNT4
Protein SequenceSynthetic peptide located within the following region: HGVSPQGFQWSGCSDNIAYGVAFSQSFVDVRERSKGASSSRALMNLHNNE
Molecular Weight39 kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti WNT-4 antibody, anti SERKAL antibody

Similar Products

  • WNT4 Rabbit Polyclonal Antibody [orb100904]

    IF,  IHC-Fr,  IHC-P,  WB

    Canine, Equine

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    200 μl, 50 μl, 100 μl
  • WNT4 Antibody (Center) [orb1929886]

    FC,  IHC-P,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    200 μl
  • WNT4 Rabbit Polyclonal Antibody [orb499619]

    IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Equine, Human, Porcine, Rabbit

    Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • WNT4 Rabbit Polyclonal Antibody [orb546300]

    ELISA,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • WNT4 rabbit pAb Antibody [orb772106]

    ELISA,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    100 μl, 50 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

WNT4 Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment.

WNT4 Rabbit Polyclonal Antibody

Sample Tissue: Mouse Testis, Antibody Dilution: 1 ug/mL.

WNT4 Rabbit Polyclonal Antibody

Positive control (+): MCF7 Cell Lysate (N10), Negative control (-): 293T Cell Lysate (2T), Antibody concentration: 1 ug/mL.

WNT4 Rabbit Polyclonal Antibody

WB Suggested Anti-WNT4 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: Jurkat cell lysate.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_110388

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

WNT4 Rabbit Polyclonal Antibody (orb329646)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 600.00
DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry