You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb577975 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to WNT2B |
| Target | WNT2B |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 1.0 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Protein A purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human WNT2B |
| Protein Sequence | Synthetic peptide located within the following region: LRTCWRALSDFRRTGDYLRRRYDGAVQVMATQDGANFTAARQGYRRATRT |
| UniProt ID | Q93097 |
| MW | 41kDa |
| Tested applications | IHC, WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | WNT13 |
| Research Area | Signal Transduction, Stem Cell & Developmental Bio Read more... |
| Note | For research use only |
| NCBI | NP_004176 |

Sample Type: Jurkat, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1.25 ug/ml, Peptide Concentration: 4.0 ug/ml, Lysate Quantity: 25 ug/lane, Gel Concentration: 12%.

Positive control (+): Human Ovary (OV), Negative control (-): Human liver (LI), Antibody concentration: 1 ug/ml.

Human Testis

Rabbit Anti-WNT2B Antibody, Paraffin Embedded Tissue: Human Lung, Cellular Data: Alveolar cells, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.
IHC, WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-Fr, IHC-P, WB | |
Canine, Equine, Gallus, Human, Porcine, Rabbit | |
Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC, WB | |
Bovine, Guinea pig, Rabbit | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Porcine, Rabbit | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review