You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb577974 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to WNT2B |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human WNT2B |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 41kDa |
Target | WNT2B |
UniProt ID | Q93097 |
Protein Sequence | Synthetic peptide located within the following region: LRTCWRALSDFRRTGDYLRRRYDGAVQVMATQDGANFTAARQGYRRATRT |
NCBI | NP_004176 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | WNT13 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Positive control (+): Human Ovary (OV), Negative control (-): Human liver (LI), Antibody concentration: 1 ug/ml.
Human Testis
Rabbit Anti-WNT2B Antibody, Paraffin Embedded Tissue: Human Lung, Cellular Data: Alveolar cells, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.
WB Suggested Antibody, Titration: 1.0 ug/ml, Positive Control: HepG2.
IHC, WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-Fr, IHC-P, WB | |
Canine, Equine, Gallus, Human, Porcine, Rabbit | |
Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC, WB | |
Bovine, Guinea pig, Rabbit | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Porcine, Rabbit | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Human, Porcine, Rabbit | |
Rabbit | |
Polyclonal | |
HRP |