You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb331248 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to WISP1 |
| Target | WISP1 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Bovine, Porcine |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Protein Sequence | Synthetic peptide located within the following region: VRPPRLWCPHPRRVSIPGHCCEQWVCEDDAKRPRKTAPRDTGAFDAVGEV |
| UniProt ID | O95388 |
| MW | 38kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | anti CCN4 antibody, anti WISP1c antibody, anti WIS Read more... |
| Research Area | Cancer, Epigenetics, Neuroscience, Signaling Pathw Read more... |
| Note | For research use only |
| NCBI | NP_003873 |

Sample Type: Human Adult Placenta, Antibody dilution: 1.0 ug/ml.

WB Suggested Anti-WISP1 Antibody, Titration: 1.0 ug/ml, Positive Control: 721_B Whole Cell, WISP1 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.
ELISA, IF, IHC-Fr, IHC-P | |
Human, Mouse, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review