Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

WASF3 Rabbit Polyclonal Antibody

SKU: orb581621

Description

WASF3 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of WASF3. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the middle region of human WASF3. This antibody reacts with Gallus, Human samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Mouse, Rat. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Musculoskeletal & Connective Tissue Research

Images & Validation

Tested ApplicationsWB
ReactivityGallus, Human
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Mouse, Rat

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human WASF3
TargetWASF3
Protein SequenceSynthetic peptide located within the following region: RIDGTTREVKKVRKARNRRQEWNMMAYDKELRPDNRLSQSVYHGASSEGS
Molecular Weight55kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

SCAR3, WAVE3, Brush-1

Similar Products

  • WASF3 Rabbit Polyclonal Antibody [orb186491]

    IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Equine, Gallus, Human, Rabbit, Sheep

    Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • WASF3 Antibody [orb685258]

    ELISA,  IHC,  WB

    Human

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • WASF3 Rabbit Polyclonal Antibody [orb304661]

    IHC,  WB

    Human, Monkey, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    30 μl, 100 μl, 200 μl, 50 μl
  • WASF3 Rabbit Polyclonal Antibody [orb581620]

    WB

    Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish

    Gallus, Human

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • WASF3 Antibody [orb672469]

    ELISA,  IHC,  WB

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    100 μg, 50 μg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

WASF3 Rabbit Polyclonal Antibody

Sample Type: 1. DF-1 cells (0.5x10^6 cells loaded), 2. MSB-1 cells (0.5x10^6 cells loaded), Primary dilution: 1:1000, Secondary Antibody: Goat anti-rabbit IgG (whole molecule) peroxidase, Secondary dilution: 1:10000.

WASF3 Rabbit Polyclonal Antibody

WB Suggested Anti-WASF3 Antibody Titration: 0.2-1 ug/ml, Positive Control: Human brain.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_006637

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

WASF3 Rabbit Polyclonal Antibody (orb581621)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry