WASF3 Rabbit Polyclonal Antibody

• Catalog Number: orb581620
• Category: Antibodies
• Description: Rabbit polyclonal antibody to WASF3
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Reactivity: Gallus, Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human WASF3
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 55kDa
• Target: WASF3
• UniProt ID: Q9UPY6
• Protein Sequence: Synthetic peptide located within the following region: NMKKAFKSSTVQDQQVVSKNSIPNPVADIYNQSDKPPPLNILTPYRDDKK
• NCBI: NP_006637
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: SCAR3, WAVE3, Brush-1
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Type: 1. DF-1 cells (0.5x10^6 cells loaded), 2. MSB-1 cells (0.5x10^6 cells loaded), Primary dilution: 1:1000, Secondary Antibody: Goat anti-rabbit IgG (whole molecule) peroxidase, Secondary dilution: 1:10000.

WB Suggested Anti-WASF3 Antibody Titration: 0.2-1 ug/ml, Positive Control: 721_B cell lysate.