VPS26A Rabbit Polyclonal Antibody

• Catalog Number: orb589942
• Category: Antibodies
• Description: Rabbit polyclonal antibody to VPS26A
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Human
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human VPS26A
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 38 kDa
• Target: VPS26A
• UniProt ID: O75436
• Protein Sequence: Synthetic peptide located within the following region: FSVRYFLNLVLVDEEDRRYFKQQEIILWRKAPEKLRKQRTNFHQRFESPE
• NCBI: NP_001030337.1
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: HB58, PEP8A, VPS26, Hbeta58
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Human A549 Whole Cell, Antibody Dilution: 1 ug/ml.

Sample Tissue: Human Neurofibroma Tumor lysates, Antibody Dilution: 1 ug/ml.

VPS26A was immunoprecipitated from 2 mg HEK293 Whole Cell Lysate with orb589942 with 1:200 dilution. Western blot was performed using orb589942 at 1/1000 dilution, Lane 1: Control IP in HEK293 Whole Cell Lysate, Lane 2: VPS26A IP with orb589942 in HEK293 Whole Cell Lysate, Lane 3: Input of HEK293 Whole Cell Lysate.