You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb331143 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to VPS26A |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Porcine, Rabbit, Rat |
Reactivity | Human, Mouse |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 36kDa |
Target | VPS26A |
UniProt ID | O75436 |
Protein Sequence | Synthetic peptide located within the following region: LVDEEDRRYFKQQEIILWRKAPEKLRKQRTNFHQRFESPESQASAEQPEM |
NCBI | NP_004887 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti FLJ12930 antibody, anti HB58 antibody, anti H Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Lanes: Lane 1: 40 ug mouse brain extract, Lane 2: 40 ug mouse brain extract, Lane 3: 40 ug mouse brain extract, Lane 4: 40 ug mouse brain extract, Primary Antibody dilution: 1:1000, Secondary Antibody: Anti-rabbit-HRP Anti-rabbit-HRP, Secondary Antibody dilution: 1:8000, Gene Name: VPS26A.
WB Suggested Anti-VPS26A Antibody, Titration: 0.5 ug/ml, Positive Control: Fetal kidney.
FC, IHC-P, WB | |
C. elegans, Mouse, Other, Rat, Zebrafish | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IF, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Gallus, Mouse, Porcine, Rabbit, Rat, Sheep | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |