You have no items in your shopping cart.
Featured
Description
Research Area
Infectious Disease & Virology
Images & Validation
−Item 1 of 2
| Application Notes |
|---|
Key Properties
−| Source | Baculovirus |
|---|---|
| Biological Origin | Vesicular stomatitis Indiana virus (strain Glasgow) (VSIV) |
| Tag | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
| Expression Region | 1-237aa |
| Protein Length | Full Length |
| MW | 30.7 kDa |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Protein Sequence | MSSLKKILGLKGKGKKSKKLGIAPPPYEEDTSMEYAPSAPIDKSYFGVDEMDTHDPNQLRYEKSFFTVKMTVRSNRPFRTYSDVAAAVSHWDHMYIGMAGKRPFYKILAFLGSSNLKATPAVLADQGQPEYHAHCEGRAYLPHRMGKTPPMLNVPEHFRRPFNIGLYKGTIELTMTIYDDESLEAAPMIWDHFNSSKFSDFREKALMFGLIVEEEASGAWVLDSVRHSKWASLASSF |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−M, Matrix protein
Similar Products
−- Item 1 of 3
Virus tetM protein [orb604953]
Greater than 85% as determined by SDS-PAGE.
32.1 kDa
E.coli
100 μg, 20 μg, 1 mg - Item 1 of 2
Recombinant Crimean-Congo hemorrhagic fever virus Envelopment polyprotein (GP), partial-VLPs [orb1881662]
The purity information is not available for VLPs proteins.
79.3 kDa
Mammalian cell
20 μg, 1 mg, 100 μg - Item 1 of 2
Virus M protein [orb605005]
Greater than 85% as determined by SDS-PAGE.
35.1 kDa
E.coli
100 μg, 20 μg, 1 mg - Item 1 of 2
Virus map-1 protein [orb605012]
Greater than 90% as determined by SDS-PAGE.
32.9 kDa
E.coli
20 μg, 100 μg, 1 mg - Item 1 of 2
Virus M protein [orb605029]
Greater than 85% as determined by SDS-PAGE.
33.5 kDa
E.coli
100 μg, 1 mg, 20 μg
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Based on the SEQUEST from database of Baculovirus host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Baculovirus-expressed Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5) DBP.
Based on the SEQUEST from database of Baculovirus host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Baculovirus-expressed Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5) DBP.
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
Virus M protein (orb595061)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a ReviewAvailable Sizes
Select a size below
Usually dispatched within 1-2 weeks