You have no items in your shopping cart.
Cart summary
Item 1 of 2
Item 1 of 2
Virus M protein
Catalog Number: orb595061
| Catalog Number | orb595061 |
|---|---|
| Category | Proteins |
| Description | Recombinant Vesicular stomatitis Indiana virus Matrix protein(M) |
| Tag | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Protein Sequence | MSSLKKILGLKGKGKKSKKLGIAPPPYEEDTSMEYAPSAPIDKSYFGVDEMDTHDPNQLRYEKSFFTVKMTVRSNRPFRTYSDVAAAVSHWDHMYIGMAGKRPFYKILAFLGSSNLKATPAVLADQGQPEYHAHCEGRAYLPHRMGKTPPMLNVPEHFRRPFNIGLYKGTIELTMTIYDDESLEAAPMIWDHFNSSKFSDFREKALMFGLIVEEEASGAWVLDSVRHSKWASLASSF |
| Protein Length | Full Length |
| UniProt ID | P04876 |
| MW | 30.7 kDa |
| Application notes | Full Length |
| Endotoxins | Not test. |
| Source | Baculovirus |
| Biological Origin | Vesicular stomatitis Indiana virus (strain Glasgow) (VSIV) |
| Expression Region | 1-237aa |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Alternative names | M, Matrix protein |
| Note | For research use only |
Based on the SEQUEST from database of Baculovirus host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Baculovirus-expressed Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5) DBP.
Based on the SEQUEST from database of Baculovirus host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Baculovirus-expressed Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5) DBP.
- Item 1 of 3
Viral Matrix protein 1 protein [orb419328]
Greater than 85% as determined by SDS-PAGE.
32.8 kDa
E.coli
20 μg, 1 mg, 100 μg - Item 1 of 3
Virus tetM protein [orb604953]
Greater than 85% as determined by SDS-PAGE.
32.1 kDa
E.coli
20 μg, 100 μg, 1 mg 
TEV-Protease [orb2568757]
Unconjugated
not determined
33 kDa (runs at 25–40 kDa on SDS-PAGE)
E.coli
1 mg- Item 1 of 2
Virus M protein [orb605005]
Greater than 85% as determined by SDS-PAGE.
35.1 kDa
E.coli
100 μg, 20 μg, 1 mg - Item 1 of 2
Virus map-1 protein [orb605012]
Greater than 90% as determined by SDS-PAGE.
32.9 kDa
E.coli
20 μg, 100 μg, 1 mg
