You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb605027 |
---|---|
Category | Proteins |
Description | Recombinant Vesicular stomatitis Indiana virus RNA-directed RNA polymerase L(L),partial |
Tag | N-terminal 6xHis-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 85% as determined by SDS-PAGE. |
MW | 25.4 kDa |
UniProt ID | Q8B0H0 |
Protein Sequence | ICIANHIDYEKWNNHQRKLSNGPVFRVMGQFLGYPSLIERTHEFFEKSLIYYNGRPDLMRVHNNTLVNSTSQRVCWQGQEGGLEGLRQKGWSILNLLVIQREAKIRNTAVKVLAQGDNQVICTQYKTKKSRNVVELQSALNQMVSNNEKIMTAIKIGTGKLGLLINDDETMQSADYLNYGKIPIFRG |
Protein Length | Partial |
Source | E.coli |
Expression System | Expression Region: 598-784aa. Protein Length: Partial |
Expression Region | 598-784aa |
Endotoxins | Not test. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Alternative names | Large structural protein Replicase Transcriptase Read more... |
Note | For research use only |
Application notes | Partial |
Expiration Date | 6 months from date of receipt. |
Greater than 85% as determined by SDS-PAGE. | |
46.7 kDa | |
Mammalian cell |
Unconjugated | |
95% | |
14.9 kDa | |
Cynomolgus / Rhesus macaque IL-15, His Tag (orb1146997) is expressed from human 293 cells (HEK293). It contains AA Asn 49 - Ser 162 (Accession # P48092-1). |
Filter by Rating