Virus Haplopelma schmidti Tau-theraphotoxin-Hs1a protein

SKU: orb604543

Description

This Virus Haplopelma schmidti Tau-theraphotoxin-Hs1a protein spans the amino acid sequence from region 1-168aa. Purity: Greater than 85% as determined by SDS-PAGE.

Research Area

Infectious Disease & Virology; Neuroscience

Images & Validation

• Application Notes:
  Partial

Key Properties

• Source: E.coli
• Biological Origin: Bovine viral diarrhea virus (strain SD-1) (BVDV) (Mucosal disease virus)
• Tag: N-terminal 10xHis-tagged
• Expression Region: 1-168aa
• Protein Length: Partial
• MW: 25.0 kDa
• Purity: Greater than 85% as determined by SDS-PAGE.
• Protein Sequence: MELITNELLYKTYKQKPVGVEEPVYDQAGNPLFGERGAIHPQSTLKLPHKRGERNVPTSLASLPKRGDCRSGNSKGPVSGIYLKPGPLFYQDYKGPVYHRAPLELFEEGSMCETTKRIGRVTGSDGKLYHIYICIDGCITVKSATRSHQRVLRWVHNRLDCPLWVTSC

Storage & Handling

• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Form/Appearance: Liquid or Lyophilized powder
• Buffer/Preservatives: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Expiration Date: 6 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

Genome polyprotein [Cleaved into, N-terminal protease, N-pro, EC 3.4.22.-, Autoprotease p20), Capsid protein C, E(rns) glycoprotein, gp44/48), Envelope glycoprotein E1, gp33), Envelope glycoprotein E2, gp55), p7, Non-structural protein 2-3, Cysteine protease NS2, EC 3.4.22.-, Non-structural protein 2), Serine protease NS3, EC 3.4.21.113, EC 3.6.1.15, EC 3.6.4.13, Non-structural protein 3), Non-structural protein 4A, NS4A), Non-structural protein 4B, NS4B), Non-structural protein 5A, NS5A), RNA-directed RNA polymerase, EC 2.7.7.48, NS5B)]

Quick Database Links

UniProt

Q01499