You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb326563 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to VCY |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Animal, Human |
Reactivity | Equine, Human |
Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human VCY |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 13kDa |
Target | VCY |
UniProt ID | O14598 |
Protein Sequence | Synthetic peptide located within the following region: RKSSSQPSPSGPKKKTTKVAEKGEAVRGGRRGKKGAATKMAAVTAPEAES |
NCBI | NP_004670 |
Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti BPY1 antibody, anti MGC119817 antibody, anti Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Western blot analysis of Jurkat Whole Cell tissue using VCY antibody
Filter by Rating