Cart summary

You have no items in your shopping cart.

VCY Rabbit Polyclonal Antibody (Biotin)

VCY Rabbit Polyclonal Antibody (Biotin)

Catalog Number: orb2090938

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2090938
CategoryAntibodies
DescriptionVCY Rabbit Polyclonal Antibody (Biotin)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityEquine, Human
ImmunogenThe immunogen is a synthetic peptide directed towards the N-terminal region of Human VCY
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationBiotin
MW13kDa
UniProt IDO14598
Protein SequenceSynthetic peptide located within the following region: RKSSSQPSPSGPKKKTTKVAEKGEAVRGGRRGKKGAATKMAAVTAPEAES
NCBINP_004670
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesBPY1, VCY1, VCY1A
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.