Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Page Not Found
Cart summary

You have no items in your shopping cart.

VAT1 Rabbit Polyclonal Antibody

SKU: orb325723

Description

VAT1 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of VAT1. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the N terminal region of human VAT1. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Mouse, Porcine, Rat, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cell Biology

Images & Validation

Tested ApplicationsWB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Mouse, Porcine, Rat, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human VAT1
TargetVAT1
Protein SequenceSynthetic peptide located within the following region: PPAPGPGQLTLRLRACGLNFADLMARQGLYDRLPPLPVTPGMEGAGVVIA
Molecular Weight42
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti FLJ20230 antibody, anti VATI antibody

Similar Products

  • SLC18A1 Rabbit Polyclonal Antibody [orb324613]

    IHC,  WB

    Bovine, Equine, Guinea pig, Mouse, Rabbit, Rat

    Human

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • VMAT1/SLC18A1 Rabbit Polyclonal Antibody [orb623824]

    ELISA,  FC,  IHC,  WB

    Human

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • VAT1 Rabbit Polyclonal Antibody [orb632490]

    ELISA,  IHC,  WB

    Human, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
  • SLC18A1 Rabbit Polyclonal Antibody [orb631229]

    ELISA,  IHC,  WB

    Human

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
  • VAT1 rabbit pAb Antibody [orb773205]

    ELISA,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    50 μl, 100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

VAT1 Rabbit Polyclonal Antibody

Sample Tissue: Human HepG2 Whole Cell, Antibody Dilution: 1 ug/mL.

VAT1 Rabbit Polyclonal Antibody

Sample Type: Jurkat, Antibody Dilution: 1.0 ug/mL, VAT1 is supported by BioGPS gene expression data to be expressed in Jurkat.

VAT1 Rabbit Polyclonal Antibody

WB Suggested Anti-VAT1 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:1562500, Positive Control: Jurkat cell lysate, VAT1 is supported by BioGPS gene expression data to be expressed in Jurkat.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_006364

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

VAT1 Rabbit Polyclonal Antibody (orb325723)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry