You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb325723 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to VAT1 |
| Target | VAT1 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Mouse, Porcine, Rat, Zebrafish |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human VAT1 |
| Protein Sequence | Synthetic peptide located within the following region: PPAPGPGQLTLRLRACGLNFADLMARQGLYDRLPPLPVTPGMEGAGVVIA |
| UniProt ID | Q99536 |
| MW | 42 |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | anti FLJ20230 antibody, anti VATI antibody |
| Research Area | Cell Biology, Stem Cell & Developmental Biology |
| Note | For research use only |
| NCBI | NP_006364 |

Sample Tissue: Human HepG2 Whole Cell, Antibody Dilution: 1 ug/mL.

Sample Type: Jurkat, Antibody Dilution: 1.0 ug/mL, VAT1 is supported by BioGPS gene expression data to be expressed in Jurkat.

WB Suggested Anti-VAT1 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:1562500, Positive Control: Jurkat cell lysate, VAT1 is supported by BioGPS gene expression data to be expressed in Jurkat.
IHC, WB | |
Bovine, Equine, Guinea pig, Mouse, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Human, Rat | |
Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review