You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb324613 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to SLC18A1 |
Target | SLC18A1 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Equine, Guinea pig, Mouse, Rabbit, Rat |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human SLC18A1 |
Protein Sequence | Synthetic peptide located within the following region: YYLRSPPAKEEKLAILSQDCPMETRMYATQKPTKEFPLGEDSDEEPDHEE |
UniProt ID | P54219 |
MW | 56 kDa |
Tested applications | IHC, WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | anti CGAT antibody, anti VAT1 antibody, anti VMAT1 Read more... |
Note | For research use only |
NCBI | NP_003044 |
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 2 ug/mL of the antibody was used in this experiment.
Brain, cortex.
Sample Tissue: Human PANC1 Whole Cell, Antibody Dilution: 1 ug/mL.
Immunohistochemistry with Brain, cortex tissue at an antibody concentration of 2.5 ug/mL using anti-SLC18A1 antibody (orb324613).
WB Suggested Anti-SLC18A1 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: 293T cell lysate.
WB | |
Human, Rat | |
Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Porcine | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Gallus, Human, Porcine | |
Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |