SLC18A1 Rabbit Polyclonal Antibody

• Catalog Number: orb324613
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SLC18A1
• Target: SLC18A1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SLC18A1
• Protein Sequence: Synthetic peptide located within the following region: YYLRSPPAKEEKLAILSQDCPMETRMYATQKPTKEFPLGEDSDEEPDHEE
• UniProt ID: P54219
• MW: 56 kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti CGAT antibody, anti VAT1 antibody, anti VMAT1
• Note: For research use only
• NCBI: NP_003044

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 2 ug/mL of the antibody was used in this experiment.

Brain, cortex.

Sample Tissue: Human PANC1 Whole Cell, Antibody Dilution: 1 ug/mL.

Immunohistochemistry with Brain, cortex tissue at an antibody concentration of 2.5 ug/mL using anti-SLC18A1 antibody (orb324613).

WB Suggested Anti-SLC18A1 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: 293T cell lysate.