You have no items in your shopping cart.
Description
Images & Validation
−
Key Properties
−| Target | others |
|---|---|
| CAS Number | 115966-23-9 |
| MW | 3506 |
| Purity | ≥95% |
| Formula | C145H234N52O44S3 |
| Protein Sequence | TAPRSLRRSSCFGGRMDRIGAQSGLGCNSFRY(Disulfide bridge Cys11- Cys 27) |
Storage & Handling
−| Expiration Date | 6 months from date of receipt. |
|---|---|
| Disclaimer | For research use only |
Similar Products
−Recombinant Human NPPA Protein, N-His-KSI [orb2961604]
ELISA, SDS-PAGE, WB
>90% as determined by SDS-PAGE.
29.44 kDa
1 mg, 50 μg, 100 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
Gene Symbol
others
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide