Cart summary

You have no items in your shopping cart.

UQCRQ Rabbit Polyclonal Antibody (HRP)

UQCRQ Rabbit Polyclonal Antibody (HRP)

Catalog Number: orb2089409

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2089409
CategoryAntibodies
DescriptionUQCRQ Rabbit Polyclonal Antibody (HRP)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityBovine, Canine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of Human UQCRQ
Form/AppearanceLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
ConjugationHRP
MW10kDa
UniProt IDO14949
Protein SequenceSynthetic peptide located within the following region: KGIPNVLRRIRESFFRVVPQFVVFYLIYTWGTEEFERSKRKNPAAYENDK
NCBINP_055217
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Alternative namesQPC, QCR8, QP-C, UQCR7, MC3DN4
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.