UQCRQ Rabbit Polyclonal Antibody

• Catalog Number: orb586759
• Category: Antibodies
• Description: Rabbit polyclonal antibody to UQCRQ
• Target: UQCRQ
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Guinea pig, Mouse, Porcine, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human UQCRQ
• Protein Sequence: Synthetic peptide located within the following region: KGIPNVLRRIRESFFRVVPQFVVFYLIYTWGTEEFERSKRKNPAAYENDK
• UniProt ID: O14949
• MW: 10kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: QPC, QCR8, QP-C, UQCR7, MC3DN4
• Research Area: Epigenetics
• Note: For research use only
• NCBI: NP_055217

25 ug of the indicated Human whole cell extracts was loaded onto a 10-20% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment.

Sample Type: Human Adult Placenta, Antibody dilution: 1.0 ug/ml.

WB Suggested Anti-UQCRQ Antibody, Titration: 1.0 ug/ml, Positive Control: Fetal Liver.